PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01270.90
Common NameJCGZ_11766, LOC105640671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Dof
Protein Properties Length: 334aa    MW: 36528.8 Da    PI: 7.3421
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01270.90genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.7e-393089261
         zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                   +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvP+Ggg+rk k+s
  Jcr4S01270.90 30 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPIGGGCRKTKRS 89
                   57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-282888IPR003851Zinc finger, Dof-type
PfamPF027014.1E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5713488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MQDIHSIGGG GRLFGGGGGD RRLRPHHHQN HQALKCPRCD SLNTKFCYYN NYNLSQPRHF  60
CKNCRRYWTK GGVLRNVPIG GGCRKTKRSK PKQNNSTTDN NTTSTTTATT TTNTTPPQPQ  120
QPQQQEQQRE RKSSNSHSSS ESSSLTATNT TTANTGLEAV SAHSSSSASN TILNGIGESK  180
LFAHGNINPS FEPGLLEQGS DCGIFSEIGS FTSLITSTNE PLSFGFSNII SQQSLEHAQQ  240
NQNEQWQQQS QPKMVSIGGE EMKMQEMAGG LIDQTVHVEL SALPSSRSGN GGFGQLDWQS  300
TGDQGLFDLS NTVDQAYWSQ SQWTDQDHPS LYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917GGRLFGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080436.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A067KGJ90.0A0A067KGJ9_JATCU; Uncharacterized protein
STRINGPOPTR_0012s12670.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-38OBF binding protein 4
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]